RECOMBINANT
Catalog no.: A 9600AG.1 / A 9600AG.2
Name: Human TGF β1 (aa 250-361)
(ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS)
Swiss-Prot No: P01137
Gene Information: Gene Name: TGFβ1, TGFβ
GenelD: 7040
Source: HEK293 cells
Storage buffer: 0.1% trifluoroacetic acid
Purity: > 98% (SDS-PAGE and HPLC)
Contents: 2 μg / 10 μg (lyophilized)
Resuspend in 10 mM citric acid pH 3.0 to a concentration of 0.1-1.0 mg/ml.
Do not vortex. For extended storage dilute further in a buffer containing a carrier protein (for example 0.1% BSA).
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English