SYNTHETIC
Catalog no.: A 1050AG.1 / A 1050AG.2
Name: Synthetic human TIP 39 (aa 62-100)
Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Synonyms: Tuberoinfundibular peptide of 39 residues, Parathyroid hormone 2
Swiss-Prot No: Q96A98
Gene Information: Gene Name: PTH2, TIP39, TIPF39
GeneID: 113091
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in aqua bidest. for required concentration
Store at: - 20 °C
Repeated thawing and freezing must be avoided
Reference:
1. Hansen IA, Jakob O, Wortmann S, Arzberger T, Allolio B, Blind E (2002). Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family. J Endocrinol 174(1): 95-102.
For research use only
中文版 | 
English