SYNTHETIC
Catalog No.: A 9525AG.1 / A 9525AG.2
Name: Human Thymosin β4 (C-terminal biotinylated)
Synonyms: T beta-4, Fx
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-L-Biotin
Underlined amino acids were added or modified for technical reasons.
MW: 5.2 kDa
Swiss-Prot No: P62328
Gene Information: Gene Name: TMSB4X, TB4X, THYB4, TMSB4
GenelD: 7114
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only