SYNTHETIC
Catalog no.: A 9522AG.1 / A 9522AG.2
Name: Human Thymosin β4 (aa 1-43)
Sequence: ACSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Synonyms: T beta-4, Fx
MW: 4963.51 Da
Swiss-Prot No: P62328
Gene Information: Gene Name: TMSB4X
Gene ID: 7114
Source: Synthetic
Purity: > 95% (HPLC)
Identity: ESI-MS
Contents: 100 μg /1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: - 20 °C
Repeated thawing and freezing must be avoided
References:
1. Smart N, Risebro CA, Melville AA, Moses K, Schwartz RJ, Chien KR, Riley PR (2007). Thymosin beta4
induces adult epicardial progenitor mobilization and neovascularization. Nature 445(7124): 177-182.
For research use only