SYNTHETIC
Catalog no.: A 9575AG.1 / A 9575AG.2
Name: Human Thymosin β15 (aa 1-45)
Synonyms: NB thymosin beta, Thymosin-like protein 8
Sequence: MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS
MW: 5.3 kDa
Swiss-Prot No: P0CG34
Gene Information: Gene Name: TMSB15A, TMSL8, TMSNB
Gene ID: 11013, 286527
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration.
Store at: - 20 °C
Repeated thawing and freezing must be avoided