SYNTHETIC
Catalog no.: AE1041AG.1 / AE1041AG.2
Name: Human SPAG11B isoform C (aa 52-88)
Synonyms: Human epididymis-specific protein 2 (He2), Protein EP2, Sperm antigen HE2
Sequence: LKVVDCRRSEGFCQEYCNYMETQVGYCSKKKDACCLH
Swiss-Prot No: Q08648-3
Gene Information: Gene Name: SPAG11B, EP2, HE2
GenelD: 10407
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only