SYNTHETIC
Catalog no.: A 8029AG.1 / A 8029AG.2
Name: Human Resistin (aa 33-90)
Synonyms: Adipose tissue-specific secretory factor, ADSF, C/EBP epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3
Sequence: CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Swiss-Prot No: Q9HD89
Gene Information: Gene Name: RETN, FIZZ3, HXCP1, RSTN
Gene ID: 56729
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in aqua bidest for required concentration.
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English