SYNTHETIC
Catalog no.: A 1118AG.1 / A 1118AG.2
Name: Human PTHrP (aa 53-84)
Synonyms: Parathyroid hormone- like protein (PLP)
Sequence: KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
MW: 4.01 kDa
Swiss-Prot No: P12272
Gene Information: Gene Name: PTHLH, PTHRP
GenelD: 5744
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration.
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only