SYNTHETIC
Catalog No.: A 1111AG.1 / A 1111AG.2
Name: Human PTH (aa 1-34)
Synonyms: Parathyrin, Parathormone
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4.12 kDa
Swiss-Prot No: P01270
Gene Information: Gene name: PTH
GenelD: 5741
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration.
Store at: - 20 °C
Repeated thawing and freezing must be avoided
For research use only