SYNTHETIC
Catalog no.: A 6104AG.1 / A 6104AG.2
Name: GLP-1 Peptide (aa 7-37)
Synonyms: Preproglucagon (aa 98-128)
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Mr: 3355.71
Swiss-Prot No: P01275
Gene Information: Gene Name: GCG
GenelD: 2641
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only