SYNTHETIC
Catalog no.: AE1110AG.1 / AE1110AG.2
Name: Human β-Defensin 2 (aa 4-41)
Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Synonyms: Beta-Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1
Swiss-Prot No: O15263
Gene Information: Gene Name: DEFB4
GenelD: 1673
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: - 20°C
Repeated thawing and freezing must be avoided
Reference:
1. Langhorst J, Junge A, Rueffer A, Wehkamp J, Foell D, Michalsen A, Musial F, Dobos GJ (2009). Elevated Human [beta]-Defensin-2 Levels Indicate an Activation of the Innate Immune System in Patients With Irritable Bowel Syndrome. Am J Gastroenterol 104(2): 404-410.
For research use only
中文版 | 
English