SYNTHETIC
Catalog No.: A 4613AG.1 / A 4613AG.2
Name: Synthetic human Calcitonin gene-related peptide 1
Synonyms: Alpha-type CGRP, Calcitonin gene-related peptide l, CGRP-I
Sequence: ACDTATCVTHRLAGLLSRSGGWVKNNFVPTNVGSKAF
MW: 3.79 kDa
Swiss-Prot No: P06881
Gene Information: Gene Name: CALCA, CALC1
Gene ID: 796
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in aqua bidest. for required concentration.
Store at: - 20°C
Repeated thawing and freezing must be avoided
For research use only