SYNTHETIC
Catalog No.: A 4612AG.1 / A 4612AG.2
Name: Synthetic human Calcitonin gene-related peptide 2
Synonyms: Beta-type CGRP, Beta-CGRP, Calcitonin gene-related peptide II, CGRP-II
Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
MW: 3.8 kDa
Swiss-Prot No: P10092
Gene Information: Gene Name: CALCB, CALC2
Gene ID: 797
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in aqua bidest. for required concentration.
Store at: - 20°C
Repeated thawing and freezing must be avoided
For research use only