RECOMBINANT
Catalog no.: A 1006AG.1 / A 1006AG.2
Name: Human proBNP (aa 1-108)
Synonyms: Natriuretic peptides B, Gamma-brain natriuretic peptide
Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM
(underlined amino acids differ from the original sequence, they were added or substituted for technical reasons)
MW: 12.183 kDa
Swiss-Prot No: P16860
Gene Information: Gene Name: NPPB
GenelD: 4879
Source: E. coli
Storage buffer: 200 mM ammonium acetate, pH 7.0
Purity: > 95% (SDS-PAGE)
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in aqua bidest. for required concentration
Store at: - 20°C
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English