RECOMBINANT
Catalog no.: A 1005AG.1 / A 1005AG.2
Name: Human N-terminal Pro-Brain Natriuretic Peptide (aa 1-76)
(APLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR)
Underlined amino acids differ from the original sequence; they were added or substituted for technical reasons
Synonyms: Natriuretic peptides B
MW: 8.390 kDa
Swiss-Prot No: P16860
Gene Information: Gene Name: NPPB
GenelD: 4879
Source: Produced in E. coli
Storage buffer: 200 mM ammonium acetate, pH 7.0
Purity: > 95 % (capillary gel electrophoresis)
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Store at: - 20°C
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English