SYNTHETIC
Catalog no.: A 1015AG.1 / A 1015AG.2
Name: Human BNP (aa 1-32), cyclic
Synonyms: Natriuretic peptides B, Gamma-brain natriuretic peptide
Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
MW: 3.5 kDa
Swiss-Prot No: P16860
Gene Information: Gene Name: NPPB
GenelD: 4879
Source: Synthetic
Purity: > 95% (HPLC)
Contents: 100 μg / 1 mg (lyophilized)
Resuspend in 0.1% acetic acid for required concentration
Store at: -20°C
Repeated thawing and freezing must be avoided
For research use only