RECOMBINANT
Catalog no.: AE1023AG.1 / AE1023AG.2
Name: Human pre-pro-ANP (aa 1-126)
(MNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRSSCFGGRMDRIGAQSGLGCNSFRY)
Underlined amino acids differ from the original sequence; they were added or substituted for technical reasons.
Synonyms: Natriuretic peptides A, CDD-ANF, Prepronatriodilatin
MW: 13.81 kDa
Swiss-Prot No: P01160
Gene Information: Gene Name: NPPA, ANP, PND
GenelD: 4878
Source: Recombinant from E. coli
Purity: > 70 % (capillary gel electrophoresis)
Contents: 20 μg / 200 μg (lyophilized)
Resuspend in aqua bidest. for required concentration
Store at: - 20°C
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English