ANTIBODY, POLYCLONAL
Catalog no.: A 1051.1 / A 1051.2
Immunogen: Synthetic human TIP 39 (aa 62-100) bTG conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)
Synonyms: Tuberoinfundibular peptide of 39 residues, Parathyroid hormone 2
Swiss-Prot No: Q96A98
Gene Information: Gene Name: PTH2, TIP39, TIPF39
Gene ID: 113091
Host: Rabbit
Matrix: Serum
Specificity: Human, bovine, and canine TIP 39
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ELISA (1:4000); RIA (1:2000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/ positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English