ANTIBODY, POLYCLONAL
Catalog no.: A 9575.1 / A 9575.2
Immunogen: Synthetic human Thymosin β15 (aa 1-45) KLH conjugated (MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS)
Synonyms: NB thymosin beta, Thymosin-like protein 8
Swiss-Prot No: POCG34
Gene Information: Gene Name: TMSB15A, TMSL8, TMSNB
GenelD: 11013, 286527
Host: Rabbit
Matrix: Serum
Specificity: Human Thymosin β15 (aa 1-45)
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ELISA (1:80 000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English