ANTIBODY, POLYCLONAL
Catalog no.: A 8029.1 / A 8029.2
Immunogen: Synthetic human Resistin (aa 33-90) bTG-conjugated
(CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP)
Synonyms: Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3
Swiss-Prot No: Q9HD89
Gene Information: Gene Name: RETN, FIZZ3, HXCP1, RSTN
GenelD: 56729
Host: Rabbit
Matrix: Serum
Specificity: Human Resistin
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ELISA
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English