ANTIBODY, POLYCLONAL
Catalog no.: A 1118.1 / A 1118.2
Immunogen: Synthetic human PTHrP (aa 53-86) KLH-conjugated (KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP)
Synonyms: Parathyroid hormone-like protein (PLP)
Swiss-Prot No: P12272
Gene Information: Gene Name: PTHLH, PTHRP
GenelD: 5744
Host: Goat
Matrix: Serum
Specificity: Human PTHrP (aa 53-86; 1-86)
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: RIA (1:2000)1
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Blind E, Raue F, Gotzmann J, Schmidt-Gayk H, KohI B, Ziegler R (1992). Circulating levels of midregional parathyroid hormone-related protein in hypercalcaemia of malignancy. Clin Endocrinol (Oxf) 37(3): 290-297.
For research use only