ANTIBODY, POLYCLONAL
Catalog no.: A 1711.1 / A 1711.2
Immunogen: Synthetic rat PTH (aa 1-34) bTG-conjugated (AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF)
Synonyms: Parathyrin, Parathormone
Swiss-Prot No: P01270
Gene Information: Gene Name: PTH
GenelD: 5741
Host: Goat
Matrix: Serum
Specificity: Rat PTH (aa 1-34)
There was no cross reactivity obtained with rat PTH (aa 53-84).
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: RIA (1:2000)1
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/ positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Kloppinger, M., Armbruster, F. P., Schaefer, L., Tampe, J., and Schmidt-Gayk, H. Homologer N-terminaler Radioimmunoassay fur Ratten-Parathormon(1-34). In: Atkinson, M., Raue, F., Schmidt-Gayk, H., Schweickert, H. U.. Wuster, C., and Ziegler, R.22.1992. Osteologie '92: Jahrestagung der Sektion Calcium-regulierende Hormone und Knochenstoffwechsel (CRHUKS) der Deutschen Gesellschaft fur Endokrinologie, 1-2 Oktober 1992, Heidelberg. 1-1-0092.
For research use only
中文版 | 
English