ANTIBODY, MONOCLONAL
Catalog no.: AK1108.1 / AK1108.2
Immunogen: Synthetic human PTH (aa 1-38) poly-Lysine conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG)
Synonyms: Parathormone, Parathyrin
Swiss-Prot No: P01270
Gene Information: Gene Name: PTH
GenelD: 5741
Host: Mouse Balb/c
Clone no.: B2-82
Isotype: lgG1
Matrix: Cell culture supernatant, affinity purified, 50 mM TRIS pH 7.4, 0.05% NaN3
Specificity: Human PTH (aa 15-25; 1-34; 1-38; 1-84; 7-84)
Affinity: 8.45 x 107 l/mol (determined by RIA)
There was no cross-reactivity obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84), or with PTHrP (aa 1-86), Calcitonin, Gastrin, β2 microglobulin, Thymulin, Thyroglobulin, Streptavidin, or Glutathione S-transferase.
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: RIA (25 ng/ml)1, ELISA (1 μg/ml)1, 2, immunohistochemistry (paraffin sections, cryosections, 2 μg/ml)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Tampe J, Broszio P, Manneck HE, Missbichler A, Blind E, Muller KB, Schmidt-Gayk H, Armbruster FP (1992). Characterization of antibodies against human N-terminal parathyroid hormone by epitope mapping. J Immunoassay 13(1): 1-13.
2. Gao P, Schmidt-Gayk H, Dittrich K, Nolting B, Maier A Roth HJ et al (1996). Immunochemiluminometric assay with two monoclonal antibodies against the N-terminal sequence of human parathyroid hormone. Clin Chim Acta 245:39-59
For research use only
中文版 | 
English