ANTIBODY, POLYCLONAL
Catalog no.: A 1114.1 / A 1114.2
Immunogen: Synthetic human PTH (aa 1-34) bTG-conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF)
Synonyms: Parathyrin, Parathormone
Swiss-Prot No: P01270
Gene Information: Gene Name: PTH
Gene ID: 5741
Host: Goat
Matrix: Serum
Specificity: Human PTH (aa 12-17, 1-34, 1-38, 1-84)
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ILMA, ELISA (1:1000)1
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Tampe J, Broszio P, Manneck HE, Missbichler A, Blind E, Muller KB, Schmidt-Gayk H, Armbruster FP (1992). Characterization of antibodies against human N-terminal parathyroid hormone by epitope mapping. J Immunoassay 13(1): 1-13.
For research use only
中文版 | 
English