ANTIBODY, MONOCLONAL
Catalog no.: A 1112.1 / A 1112.2
Immunogen: Synthetic human PTH (aa 1-34) BSA conjugated (SVSEIYLMHNLGKHLNSMERVEWLRKKLYDVHNF)
Synonyms: Parathyrin, Parathormone
Swiss-Prot No: P01270
Gene Information: Gene name: PTH
GenelD: 5741
Host: Rat
Isotype: IgG2b
Matrix: Cell supernatant; Prot. G purified; PBS pH 7.4
Specificity: Human oxidized PTH (aa 1-34)
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: Immunoprecipitation (affinity chromatography)1
This antibody has not been tested for use in all aplications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/ positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Hocher B, Armbruster FP, Stoeva S, Reichetzeder C Gron HJ, Lieker I, Khadzhynov D, Slowinski T, Roth HJ (2012). Measuring parathyroid hormone (PTH) in patients with oxidative stress--do we need a fourth generation parathyroid hormone assay? PLoS One 7(7): e40242.
For research use only
中文版 | 
English