ANTIBODY, POLYCLONAL
Catalog no.: A 1117.1 / A 1117.2
Immunogen: Synthetic human PTH (aa 1-34), bTG-conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF)
Synonyms: Parathormone, Parathyrin
Swiss-Prot No: P01270
Gene Information: Gene Name: PTH
GenelD: 5741
Host: Rabbit
Matrix: Serum
Specificity: Human PTH (aa 15-25; 1-34; 1-38; 1-84; 7-84)
There was no cross reactivity obtained with synthetic human PTH (aa 1-10).
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ELISA (1:3000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Stadler A. Homologous Radioimmunoassay for Human Parathyroid Hormone (Residues 1-34) with Biotinylated Peptide as Tracer. In: Schmidt-Gayk H, Armbruster FP, Bouillon R, eds. Calcium Regulating Hormones, Vitamin D Metabolites, and Cyclic AMP. Berlin: Springer-Verlag, 1990:137-50.
For research use only
中文版 | 
English