ANTIBODY, POLYCLONAL
Catalog no.: A 6102.1 / A 6102.2
Immunogen: Synthetic human GLP-2, KLH-conjugated (HADGSFSDEMNTILDNLAARDFINWLIQTKITD)
Synonyms: GLP-2, Glucagon (aa 126–158)
Swiss-Prot No: P01275
Gene Information: Gene Name: GCG
GeneID: 2641
Host: Rabbit
Matrix: Serum
Specificity: Human GLP-2
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: ELISA (1:3000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English