ANTIBODY, POLYCLONAL
Catalog no.: A 1081.1 / A 1081.2
Immunogen: Synthetic human β-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Synonyms: Beta Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1
Swiss-Prot No: O15263
Gene Information:
Gene Name: DEFB4
GenelD: 1673
Host: Sheep
Matrix: Serum
Specificity: Synthetic human β-Defensin 2 (aa 4-41)
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: ELISA (1 :5000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English