ANTIBODY, POLYCLONAL
Catalog no.: A 1081.3 / A 1081.4
Immunogen: Synthetic human β-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Synonyms: Beta Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1
Swiss-Prot No: O15263
Gene Information:
Gene Name: DEFB4
GenelD: 1673
Host: Sheep
Matrix: lgG, Protein G purified from serum; 50 mM TRIS pH7.4
Specificity: Synthetic human β-Defensin 2 (aa 4-41)
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: ELISA (1:5000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions/concentrations in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English