ANTIBODY, MONOCLONAL
Catalog no.: AE1110.1 / AE1110.2
Immunogen: Synthetic human β-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Synonyms: Defensin beta 2, hBD-2, Skin-antimicrobial peptide 1 (SAP1)
Swiss-Prot No: O15263
Gene Information: Gene Name: DEFB4A, DEFB102, DEFB2, DEFB4, and DEFB4B
GenelD: 1673 and 100289462
Host: Mouse Balb/c
Clone no.: L12-4C-C2
Isotype: IgG1
Matrix: Cell culture supernatant, Protein G purified, PBS, pH 7.4
Specificity: Human β-Defensin 2
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: ELISA Western Blot (5 μg/ml)1, immunohistochemistry (parffin sections, 1:2000)1
This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized);- 20 °C (dissolved)
Repeated thawing and feezing must be avoided
References:
1. Langhorst J, Junge A, Rueffer A, Wehkamp J, Foell D, Michalsen A Musial F, Dobos GJ (2009).
Elevated Human [beta]-Defensin-2 Levels Indicate an Activation of the Innate Immune System in
Patients With Irritable Bowel Syndrome.Am J Gastroenterol 104(2): 404-410.