ANTIBODY, MONOCLONAL
Catalog no.: AE1109.1 / AE1109.2
Immunogen: Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)(DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Synonyms: Beta-Defensin 1, beta 1, BD-1
Swiss-Prot No: P60022
Gene Information:
Gene Name: DEFB1
GenelD: 1672
Host: Mouse Balb/c
Clone no: M4-14b-H4
Isotype: lgG1
Matrix: Cell culture supernatant, Protein G purified, PBS pH 7.4
Specificity: Synthetic human β-Defensin 1 (aa 1-36)
There was no cross reactivity obtained with human β-Defensin 3, β-Defensin 4, β-Defensin 12, and β-Defensin 16.
Contents: 10 μg / 100 μg (lyophilized)
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: ELISA, Western Blot
This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrate the antibody in his/her system using appopriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
中文版 | 
English