ANTIBODY, POLYCLONAL
Catalog no.: A 4111.1 / A 4111.2
Immunogen: Synthetic human Calcitonin, BSA-conjugated (CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP)
Swiss-Prot No: P01258
Gene Information:
Gene Name: CALCA, CALC1
GenelD: 796
Host: Sheep
Matrix: Serum
Specificity: Human Calcitonin
There was no cross reactivity obtained with human Katacalcin or human Calcitonin Gene related Peptide.
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: RIA (1:80 000)
This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only
中文版 | 
English