ANTIBODY, MONOCLONAL
Catalog no.: A 1044.1 / A 1044.2
Immunogen: Synthetic human BNP (aa 1-32) KLH-conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
Synonyms: Brain natriuretic peptide 32, BNP-32
Swiss-Prot No: P16860
Gene Information:
Gene Name: NPPB
GenelD: 4879
Host: Mouse Balb/c
Clone no.: 3-21
Isotype: IgG2b kappa
Matrix: Cell culture supernatant Protein G purified, PBS pH 7.4
Specificity: Synthetic human BNP (aa 1-32), recombinant proBNP (aa1-108)
Contents: 10 μg / 100 μg
Resuspend in 10 μl / 100 μl aqua bidest.
Known applications: ELISA
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/ positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
For research use only