ANTIBODY, POLYCLONAL
Catalog no.: AE1026.1 / AE1026.2
Immunogen: Synthetic human proANP (aa 1-30) thyroglobulin-coupled
(NPMYNAVSNADLMDFKNLLDHLEEKMPLED)
Synonyms: Atrial natriuretic factor (ANF), CDD-ANF, Prepronatriodilatin
Swiss-Prot No: P01160
Gene Information: Gene Name: NPPA, ANP, PND
Gene ID: 4878
Host: Sheep
Matrix: Serum
Specificity: Synthetic human proANP (aa 1-30)
There was no cross reactivity obtained with human proANP (aa 31-67, 79-98), or human ANP (aa 1-28), or human proBNP (1-76).
Contents: 20 μl / 100 μl (lyophilized)
Resuspend in 20 μl / 100 μl aqua bidest.
Known applications: RIA (1:5000), ELISA1
This antibody has not been tested for use in all applications. This does not necessarily exclude its use in non-tested procedures. The stated dilutions are recommendations only. End users should determine optimal dilutions in their system using appropriate negative/positive controls.
Store at: 2-8 °C (lyophilized); - 20 °C (dissolved)
Repeated thawing and freezing must be avoided
References:
1. Hartter E, Khalafpour S, Missbichler A, Hawa G, Woloszczuk W (2000). Enzyme immunoassays for fragments (epitopes) of human proatrial natriuretic peptides. Clin Chem Lab Med 38:27-32.
For research use only
中文版 | 
English